Header of the page

BLASTX 2.2.15 [Oct-15-2006] 
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

RID: 1168941019-2700-52196857227.BLASTQ1


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
           4,458,890 sequences; 1,532,996,420 total letters

 
If you have any problems or questions with the results of this search 
please refer to the BLAST FAQs
Taxonomy reports

Query=  Contig170
Length=394

Distribution of 1 Blast Hits on the Query Sequence


                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

gi|92880921|gb|ABE85945.1|  Retrieval of early ER protein Rer1 [M  32.3    0.51
Alignments

>gi|92880921|gb|ABE85945.1|  Retrieval of early ER protein Rer1 [Medicago truncatula]
Length=197

 Score = 32.3 bits (72),  Expect = 0.51
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)
 Frame = -3

Query  392  QIAHMIXIQVYPNSTLEKQKYTGKESFLQVASG  294
            QIAHMI  +  P S L KQKY GK+S+   +SG
Sbjct  162  QIAHMIKYRYIPFS-LGKQKYGGKKSYASSSSG  193







  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding 
environmental samples
    Posted date:  Jan 15, 2007  4:53 AM
  Number of letters in database: 101,054,579
  Number of sequences in database:  283,349
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 283349
Number of Hits to DB: 249
Number of extensions: 2
Number of successful extensions: 0
Number of sequences better than 10: 0
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 0
Number of HSP's successfully gapped: 0
Length of query: 394
Length of database: 101054579
Length adjustment: 97
Effective length of query: 297
Effective length of database: 73569726
Effective search space: 2501370684
Effective search space used: 2501370684
T: 12
A: 40
X1: 16 (7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (20.4 bits)
S2: 61 (28.1 bits)