Header of the page

BLASTX 2.2.15 [Oct-15-2006] 
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

RID: 1168939123-11326-169724177585.BLASTQ1


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
           4,458,890 sequences; 1,532,996,420 total letters

 
If you have any problems or questions with the results of this search 
please refer to the BLAST FAQs
Taxonomy reports

Query=  Contig227
Length=318

Distribution of 1 Blast Hits on the Query Sequence


                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

gi|140487|sp|P05724|YCX3_CHLRE  Hypothetical 14.4 kDa protein ...  29.3    4.3
Alignments

>gi|140487|sp|P05724|YCX3_CHLRE  Hypothetical 14.4 kDa protein in 16S rRNA region
 gi|13508910|emb|CAC35219.1|  hypothetical protein [Chlamydomonas reinhardtii]
Length=124

 Score = 29.3 bits (64),  Expect = 4.3
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 5/46 (10%)
 Frame = -3

Query  295  QKWHETSKLYWMNTTVFYFLVYPNMGLTPNQ--DVKSFNQRNSLDT  164
            Q W+E +K   +   ++YF++Y    +T N    V++ NQ+N L T
Sbjct  54   QFWYEFTKKQKLKNALYYFVIY---DITDNSILPVETLNQKNPLST  96







  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding 
environmental samples
    Posted date:  Jan 15, 2007  4:53 AM
  Number of letters in database: 101,054,579
  Number of sequences in database:  283,349
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 283349
Number of Hits to DB: 179
Number of extensions: 0
Number of successful extensions: 0
Number of sequences better than 10: 0
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 0
Number of HSP's successfully gapped: 0
Length of query: 318
Length of database: 101054579
Length adjustment: 75
Effective length of query: 243
Effective length of database: 79803404
Effective search space: 2473905524
Effective search space used: 2473905524
T: 12
A: 40
X1: 16 (7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (20.4 bits)
S2: 61 (28.1 bits)