Header of the page

BLASTX 2.2.15 [Oct-15-2006] 
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

RID: 1168939236-31679-115191785621.BLASTQ1


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
           4,458,890 sequences; 1,532,996,420 total letters

 
If you have any problems or questions with the results of this search 
please refer to the BLAST FAQs
Taxonomy reports

Query=  Contig232
Length=247

Distribution of 1 Blast Hits on the Query Sequence


                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

gi|15242877|ref|NP_198341.1|  unknown protein [Arabidopsis thalia  28.5    7.4   UniGene infoGene info
Alignments

>gi|15242877|ref|NP_198341.1| UniGene infoGene info unknown protein [Arabidopsis thaliana]
Length=203

 Score = 28.5 bits (62),  Expect = 7.4
 Identities = 16/66 (24%), Positives = 34/66 (51%), Gaps = 2/66 (3%)
 Frame = +2

Query  53   KKKKERHWAKCRPSSTAQIKLQ*VQFFFYAPQNEGEKANERNFRNSGNVIC-QPLVIFRG  229
            K++++  +A    S+ AQ++ Q +    +  + +  K NE N ++   +   + LV+F  
Sbjct  82   KRRRKESYASSSTSTVAQLQEQ-LHLKIFELEEQNAKRNEENHQSQSRIASLEKLVLFMK  140

Query  230  QYQPEL  247
            +  PEL
Sbjct  141  EKDPEL  146







  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding 
environmental samples
    Posted date:  Jan 15, 2007  4:53 AM
  Number of letters in database: 101,054,579
  Number of sequences in database:  283,349
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 283349
Number of Hits to DB: 164
Number of extensions: 4
Number of successful extensions: 0
Number of sequences better than 10: 0
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 0
Number of HSP's successfully gapped: 0
Length of query: 247
Length of database: 101054579
Length adjustment: 53
Effective length of query: 194
Effective length of database: 86037082
Effective search space: 2495075378
Effective search space used: 2495075378
T: 12
A: 40
X1: 16 (7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (20.4 bits)
S2: 61 (28.1 bits)