LOCUS       AZOSBRAS1               1121 bp    DNA     linear   BCT 02-JUN-2000
DEFINITION  Azospirillum brasilense unknown gene.
ACCESSION   AF083218
VERSION     AF083218.2  GI:8170798
KEYWORDS    .
SEGMENT     1 of 2
SOURCE      Azospirillum brasilense
  ORGANISM  Azospirillum brasilense
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
            Rhodospirillaceae; Azospirillum.
REFERENCE   1  (bases 1 to 1121)
  AUTHORS   Revers,L.F., Passaglia,L.M., Marchal,K., Frazzon,J., Blaha,C.G.,
            Vanderleyden,J. and Schrank,I.S.
  TITLE     Characterization of an Azospirillum brasilense Tn5 mutant with
            enhanced N(2) fixation: the effect of ORF280 on nifH expression
  JOURNAL   FEMS Microbiol. Lett. 183 (1), 23-29 (2000)
   PUBMED   10650197
REFERENCE   2  (bases 1 to 1121)
  AUTHORS   Revers,L.F., Passaglia,L.M.P. and Schrank,I.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-1998) Biotechnology, Federal University of Rio
            Grande do Sul, Av. Bento Goncalves, 9500, Bloco IV, Porto Alegre,
            RS 91501-970, Brazil
REFERENCE   3  (bases 1 to 1121)
  AUTHORS   Blaha,C.A.G., Passaglia,L.M.P. and Schrank,I.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUN-2000) Biotechnology, Federal University of Rio
            Grande do Sul, Av. Bento Goncalves, 9500, Bloco IV, Porto Alegre,
            RS 91501-970, Brazil
  REMARK    Sequence update by submitter
COMMENT     On Jun 2, 2000 this sequence version replaced gi:3493650.
FEATURES             Location/Qualifiers
     source          1..1121
                     /organism="Azospirillum brasilense"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:192"
     CDS             438..1013
                     /note="ORF281; similar to Blepharisma japonicum ORF277 and
                     Paracoccus denitrificans ORF278 which belong to oxidase
                     gene cluster induced upon oxygen limitation"
                     /codon_start=1
                     /transl_table=11
                     /product="unknown"
                     /protein_id="AAC33476.2"
                     /db_xref="GI:8170799"
                     /translation="MAGPLRSPDGQRRRCMDATPTWWWLGRPIRTATVTARSRFRRIW
                     CSNAGVRCWSCPTPALSPTSGNRRVLVAWNGSREAARAVADAMPILTAAKRVVVMAVN
                     PKAGPAGIGDEPGADIAKHLSRHGCRVEATHIVTDQIDPGDTLLNTVADESCDLLVMG
                     AYARSRVREQVLGGMTRYMLEHMTVPVLMSH"
ORIGIN      
        1 gaattctagg ctgttgaccg gaccggtggc gcgcgcagag gcggcatgcc agcgttcccc
       61 attctgacca tcgtcagaga cggccatgcg cggctataat ttcgaccaat gcgcgagaag
      121 aggtggtgca caacgatcgc ccacccgcgc gagcgaggga gaatcgccat ggcactcaag
      181 gacctgctgg tggtcgtcga cgacaccgcc gccgctgcgg cgcgaatcga tgccgccgcc
      241 caactggccg cgcgcaccga cggccacatc accggcctct accccgtcgt tccgctgacc
      301 ctgccgggct acgtcgaggc ggaactgccg gacgaggtgc gcgccatgca gcgcggctac
      361 accgagaacc agaccgccag ggcggaggct ctcttcgccg acgcggtgcg ccgcaacggc
      421 ctgaccgacc gctcggaatg gcgggtcctc tacggtcacc cgacggacag cgccggcgct
      481 gcatggacgc tacgccgacg tggtggtggt tgggcaggcc gatccgcacc gcgaccgtga
      541 ccgcccgatc gcggttccgc aggatctggt gttcgaatgc gggcgtccgc tgctggtcgt
      601 gccctacgcc ggctctttcc cccacatcgg ggaaccgccg cgtgctggtc gcctggaacg
      661 gcagccgcga agcggcccgc gcggtggccg acgcgatgcc catcctcacc gccgccaagc
      721 gcgtggtggt catggccgtc aaccccaagg ccggccccgc cggcatcggc gacgagccgg
      781 gcgccgacat cgccaagcac ctgtcgcgcc atggctgccg ggtggaggcc acccacatcg
      841 tgaccgacca gatcgatccg ggcgacacgc tgctgaacac ggtcgccgac gaatcctgcg
      901 atcttctggt catgggcgcc tatgcgcgct cgcgcgtgcg cgaacaggtg ctgggcggca
      961 tgacccgcta catgctggag cacatgacgg ttccggtcct gatgagccat tgaggcccac
     1021 tgaacgtcgg tcgccggctt gtccgggagt cgtctggccg ggaatagtcc ggcagggccg
     1081 cctgttcatc ccagtgaggc cggcgccgga cttcggtcga c
//