Header of the page

BLASTX 2.2.15 [Oct-15-2006]
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

RID: 1168923207-18975-11370567386.BLASTQ1


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
           4,458,890 sequences; 1,532,996,420 total letters

If you have any problems or questions with the results of this search
please refer to the BLAST FAQs Taxonomy reports

Query=  Contig9
Length=337


Distribution of 1 Blast Hits on the Query Sequence



                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

gi|13507023|gb|AAK28402.1|AF250228_1  7S globulin [Elaeis guineen  89.0    5e-18
Alignments
>gi|13507023|gb|AAK28402.1|AF250228_1 7S globulin [Elaeis guineensis] Length=572 Score = 89.0 bits (219), Expect = 5e-18 Identities = 61/61 (100%), Positives = 61/61 (100%), Gaps = 0/61 (0%) Frame = +3 Query 24 MTIKPRAFVPFLLLLSILFVSATLTFSATTEDPKQRLERCKqecresrqgerqerrCVSQ 203 MTIKPRAFVPFLLLLSILFVSATLTFSATTEDPKQRLERCKQECRESRQGERQERRCVSQ Sbjct 1 MTIKPRAFVPFLLLLSILFVSATLTFSATTEDPKQRLERCKQECRESRQGERQERRCVSQ 60 Query 204 C 206 C Sbjct 61 C 61
  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding 
environmental samples
    Posted date:  Jan 15, 2007  4:53 AM
  Number of letters in database: 101,054,579
  Number of sequences in database:  283,349
Lambda     K      H
   0.307    0.121    0.322 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 283349
Number of Hits to DB: 61
Number of extensions: 1
Number of successful extensions: 0
Number of sequences better than 10: 0
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 0
Number of HSP's successfully gapped: 0
Length of query: 337
Length of database: 101054579
Length adjustment: 80
Effective length of query: 257
Effective length of database: 78386659
Effective search space: 2508373088
Effective search space used: 2508373088
T: 12
A: 40
X1: 16 (7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (20.4 bits)
S2: 61 (28.1 bits)