Header of the page

BLASTX 2.2.15 [Oct-15-2006] 
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman 
(1997), "Gapped BLAST and PSI-BLAST: a new generation of 
protein database search programs", Nucleic Acids Res. 25:3389-3402.

RID: 1168930324-23964-50215615789.BLASTQ4


Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
           4,458,890 sequences; 1,532,996,420 total letters

 
If you have any problems or questions with the results of this search 
please refer to the BLAST FAQs
Taxonomy reports

Query=  Contig137
Length=386

Distribution of 1 Blast Hits on the Query Sequence


                                                                   Score     E
Sequences producing significant alignments:                       (Bits)  Value

gi|1363478|pir||S57850  probable NADH2 dehydrogenase (ubiquino...  28.1    9.7
Alignments

>gi|1363478|pir||S57850  probable NADH2 dehydrogenase (ubiquinone) (EC 1.6.5.3) chain 
1 - watermelon mitochondrion
 gi|12875|emb|CAA27743.1|  URF-1 [Citrullus lanatus]
Length=316

 Score = 28.1 bits (61),  Expect = 9.7
 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 0/37 (0%)
 Frame = -1

Query  347  VVTSLLVSHTTKSKLQLYIKRIIISRLLPFKVCKYIC  237
            ++TS + S TTK   Q+ +  + +SR  PF  C + C
Sbjct  5    ILTSFMRSRTTKPPPQIKMSPMRLSRQEPFFDCDFFC  41







  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding 
environmental samples
    Posted date:  Jan 15, 2007  4:53 AM
  Number of letters in database: 101,054,579
  Number of sequences in database:  283,349
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 283349
Number of Hits to DB: 186
Number of extensions: 2
Number of successful extensions: 0
Number of sequences better than 10: 0
Number of HSP's better than 10 without gapping: 0
Number of HSP's gapped: 0
Number of HSP's successfully gapped: 0
Length of query: 386
Length of database: 101054579
Length adjustment: 94
Effective length of query: 292
Effective length of database: 74419773
Effective search space: 2530272282
Effective search space used: 2530272282
T: 12
A: 40
X1: 16 (7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (20.4 bits)
S2: 61 (28.1 bits)