LOCUS       DQ177762                 629 bp    DNA     linear   PLN 13-JAN-2006
DEFINITION  Chamaedorea tepejilote phosphoribulokinase-like protein 2 (PRK)
            gene, exons 4, 5 and partial cds.
ACCESSION   DQ177762
VERSION     DQ177762.1  GI:76881607
KEYWORDS    .
SOURCE      Chamaedorea tepejilote
  ORGANISM  Chamaedorea tepejilote
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Arecaceae; Arecoideae;
            Chamaedoreeae; Chamaedorea.
REFERENCE   1  (bases 1 to 629)
  AUTHORS   Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A.,
            Russell,S.J., Hodel,D.R. and Bateman,R.M.
  TITLE     Molecular phylogeny of the palm genus Chamaedorea, based on the
            low-copy nuclear genes PRK and RPB2
  JOURNAL   Mol. Phylogenet. Evol. 38 (2), 398-415 (2006)
   PUBMED   16249101
REFERENCE   2  (bases 1 to 629)
  AUTHORS   Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A.,
            Russell,S.J., Hodel,D.R. and Bateman,R.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-AUG-2005) Botany, Natural History Museum, Cromwell
            Road, London SW7 5BD, UK
FEATURES             Location/Qualifiers
     source          1..629
                     /organism="Chamaedorea tepejilote"
                     /mol_type="genomic DNA"
                     /specimen_voucher="S. Henderson 385 FTG"
                     /db_xref="taxon:348503"
     gene            <1..>629
                     /gene="PRK"
     mRNA            join(<1..60,474..>629)
                     /gene="PRK"
                     /product="phosphoribulokinase-like protein 2"
     CDS             join(<1..60,474..>629)
                     /gene="PRK"
                     /codon_start=3
                     /product="phosphoribulokinase-like protein 2"
                     /protein_id="ABA56432.1"
                     /db_xref="GI:76881608"
                     /translation="LECIKASIGARKLDFDAYVDLQKQYADVVIEVLPTQLIPDDNER
                     KVLRVRLVMKEGVKYCNPVYLLDEGST"
     exon            <1..60
                     /gene="PRK"
                     /number=4
     exon            474..>629
                     /gene="PRK"
                     /number=5
ORIGIN      
        1 gtcttgagtg catcaaagcc agcattggag ctcgaaagct cgactttgat gcttatgttg
       61 gtatgtttct ttgccacagt gcctagttat tggtacttga acaattggca gagcatttat
      121 ttgttggtat aatatagagc aatttcatta gttttgattg ccaaatatag tactatactt
      181 caatatctag caaatgcttc attaaaaaaa gaactcgcta acaaagtatc tgatccataa
      241 gtcaaataat gcacaaaaca tactggacta aaaatataat cactccatga gaaatacttt
      301 tggatacctt tttctggaaa aaagaaaaag ggagagcaaa ccccaaccaa ttcattgaga
      361 taattagaca attttatgtg tggagtctcc atgttcttca gatatcagaa tacatgtctt
      421 tttctttagc actcttggat tgctggcagc ttattgattg ctacccttgg cagacctgca
      481 gaagcaatat gctgatgtcg tgatcgaagt tttaccgaca caattaattc ctgatgacaa
      541 tgaaaggaag gtgctgagag ttcgattggt gatgaaggaa ggggtgaagt attgcaatcc
      601 agtttacctc ttagatgaag gctccaccg