LOCUS DQ177765 629 bp DNA linear PLN 13-JAN-2006 DEFINITION Chamaedorea fragrans phosphoribulokinase-like protein 2 (PRK) gene, exons 4, 5 and partial cds. ACCESSION DQ177765 VERSION DQ177765.1 GI:76881613 KEYWORDS . SOURCE Chamaedorea fragrans ORGANISM Chamaedorea fragrans Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Arecaceae; Arecoideae; Chamaedoreeae; Chamaedorea. REFERENCE 1 (bases 1 to 629) AUTHORS Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A., Russell,S.J., Hodel,D.R. and Bateman,R.M. TITLE Molecular phylogeny of the palm genus Chamaedorea, based on the low-copy nuclear genes PRK and RPB2 JOURNAL Mol. Phylogenet. Evol. 38 (2), 398-415 (2006) PUBMED 16249101 REFERENCE 2 (bases 1 to 629) AUTHORS Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A., Russell,S.J., Hodel,D.R. and Bateman,R.M. TITLE Direct Submission JOURNAL Submitted (19-AUG-2005) Botany, Natural History Museum, Cromwell Road, London SW7 5BD, UK FEATURES Location/Qualifiers source 1..629 /organism="Chamaedorea fragrans" /mol_type="genomic DNA" /specimen_voucher="S. Henderson 371 FTG" /db_xref="taxon:348467" gene <1..>629 /gene="PRK" mRNA join(<1..60,474..>629) /gene="PRK" /product="phosphoribulokinase-like protein 2" CDS join(<1..60,474..>629) /gene="PRK" /codon_start=3 /product="phosphoribulokinase-like protein 2" /protein_id="ABA56435.1" /db_xref="GI:76881614" /translation="LECIKASIGARKLDFDAYVDLQKQYADVVIEVLPTQLIPDDNER KVLRVRLVMKEGVKYCNPVYLLDEGST" exon <1..60 /gene="PRK" /number=4 exon 474..>629 /gene="PRK" /number=5 ORIGIN 1 gtcttgagtg catcaaagcc agcattggag ctcgaaagct cgactttgat gcttatgttg 61 gtatgtcact ttgccacagt gcctagttat tggtacttga agaattggca gagcattcat 121 ttgttggtat aatatagagc aatttcatta gttttgattg ccaaatatag tactatactt 181 caatatctag caaatgcttc attaaaaaaa gaactcgcta acaaagtatc tgatccataa 241 gtcaaataat gcacaaaaca tactggacta aatatataat cactccatga gaaatacttt 301 tggatacctt tttctgaaaa aaagaaagag ggagagcaaa ccccaaccaa ttcattgaga 361 taatgagaca attttatgtg tggagtctca tgttcttcag atatcagaat acatgtcttt 421 tttmtttagc actcttggat tgatggcagc ttatagattg ctacccttgg cagacctgca 481 gaagcaatat gctgatgtcg tgatcgaagt tttaccgaca caattaattc ctgatgacaa 541 tgaaaggaag gtgctgagag ttcgattggt gatgaaggaa ggggtgaagt attgcaatcc 601 agtttacctc ttagatgaag gctccaccg