LOCUS       DQ177775                 615 bp    DNA     linear   PLN 13-JAN-2006
DEFINITION  Chamaedorea dammeriana phosphoribulokinase-like protein 2 (PRK)
            gene, exons 4, 5 and partial cds.
ACCESSION   DQ177775
VERSION     DQ177775.1  GI:76881633
KEYWORDS    .
SOURCE      Chamaedorea dammeriana
  ORGANISM  Chamaedorea dammeriana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Arecaceae; Arecoideae;
            Chamaedoreeae; Chamaedorea.
REFERENCE   1  (bases 1 to 615)
  AUTHORS   Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A.,
            Russell,S.J., Hodel,D.R. and Bateman,R.M.
  TITLE     Molecular phylogeny of the palm genus Chamaedorea, based on the
            low-copy nuclear genes PRK and RPB2
  JOURNAL   Mol. Phylogenet. Evol. 38 (2), 398-415 (2006)
   PUBMED   16249101
REFERENCE   2  (bases 1 to 615)
  AUTHORS   Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A.,
            Russell,S.J., Hodel,D.R. and Bateman,R.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-AUG-2005) Botany, Natural History Museum, Cromwell
            Road, London SW7 5BD, UK
FEATURES             Location/Qualifiers
     source          1..615
                     /organism="Chamaedorea dammeriana"
                     /mol_type="genomic DNA"
                     /specimen_voucher="S. Henderson 389 FTG"
                     /db_xref="taxon:348463"
     gene            <1..>615
                     /gene="PRK"
     mRNA            join(<1..46,460..>615)
                     /gene="PRK"
                     /product="phosphoribulokinase-like protein 2"
     CDS             join(<1..46,460..>615)
                     /gene="PRK"
                     /codon_start=1
                     /product="phosphoribulokinase-like protein 2"
                     /protein_id="ABA56445.1"
                     /db_xref="GI:76881634"
                     /translation="TASIGARKLDFDAYVDLQKQYADVVIEVLPTQLIPDDNERKVLR
                     VRLVMKEGVKYCNPVYLLDEGST"
     exon            <1..46
                     /gene="PRK"
                     /number=4
     exon            460..>615
                     /gene="PRK"
                     /number=5
ORIGIN      
        1 acagccagca ttggagctcg aaagctcgac tttgatgctt atgttggtat gtcactttgc
       61 cacagtgcct agttattggt acttgaagaa ttggcagagc attcatttgt tggtataata
      121 tagagcaatt tcattagttt tgattgccaa atatagtact atacttcaat atctagcaaa
      181 tgcttcatta aaaaaagaac tcgctaacaa agtatctgat ccataagtca aataatgcac
      241 aaaacatact ggactaaata tataatcact ccatgagaaa tacttttgga tacctttttc
      301 tgaaaaaaag aaagagggag agcaaacccc aaccaattca ttgagataat gagacaattt
      361 tatgtgtgga gtctcatgtt cttcagatat cagaatacat gtctttttta tttagcactc
      421 ttggattgat ggcagcttat agattgctac ccttggcaga cctgcagaag caatatgctg
      481 atgtcgtgat cgaagtttta ccgacacaat taattcctga tgacaatgaa aggaaggtgc
      541 tgagagttcg attggtgatg aaggaagggg tgaagtattg caatccagtt tacctcttag
      601 atgaaggctc caccg