LOCUS DQ177777 628 bp DNA linear PLN 13-JAN-2006 DEFINITION Chamaedorea stricta phosphoribulokinase-like protein 2 (PRK) gene, exons 4, 5 and partial cds. ACCESSION DQ177777 VERSION DQ177777.1 GI:76881637 KEYWORDS . SOURCE Chamaedorea stricta ORGANISM Chamaedorea stricta Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Arecaceae; Arecoideae; Chamaedoreeae; Chamaedorea. REFERENCE 1 (bases 1 to 628) AUTHORS Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A., Russell,S.J., Hodel,D.R. and Bateman,R.M. TITLE Molecular phylogeny of the palm genus Chamaedorea, based on the low-copy nuclear genes PRK and RPB2 JOURNAL Mol. Phylogenet. Evol. 38 (2), 398-415 (2006) PUBMED 16249101 REFERENCE 2 (bases 1 to 628) AUTHORS Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A., Russell,S.J., Hodel,D.R. and Bateman,R.M. TITLE Direct Submission JOURNAL Submitted (19-AUG-2005) Botany, Natural History Museum, Cromwell Road, London SW7 5BD, UK FEATURES Location/Qualifiers source 1..628 /organism="Chamaedorea stricta" /mol_type="genomic DNA" /specimen_voucher="Hodel 916 BH" /db_xref="taxon:348501" gene <1..>628 /gene="PRK" mRNA join(<1..60,473..>628) /gene="PRK" /product="phosphoribulokinase-like protein 2" CDS join(<1..60,473..>628) /gene="PRK" /codon_start=3 /product="phosphoribulokinase-like protein 2" /protein_id="ABA56447.1" /db_xref="GI:76881638" /translation="LECIKASIGARKLDFDAYVDLQKQYADVVIEVLPTQLIPDDNER KVLRVRLVMKEGVKYCNPVYLLDEGST" exon <1..60 /gene="PRK" /number=4 exon 473..>628 /gene="PRK" /number=5 ORIGIN 1 gtcttgagtg catcaaagcc agcattggag ctcgaaagct cgactttgat gcttatgttg 61 gtatgtttct ttgccacagt gcctagttat tggtacttga agaattggca gagcattcct 121 ttgttggtat aatatagagc aatttcatta gttttgattg ccaaatatag tactatactt 181 caatatctag caaatgcttc attacaaaaa gaactcacta acaaagtatc tgatccataa 241 gtcaaataat gcacaaaaca tactggacta aaaatataat cactccatga gaaatacttt 301 tggatacctt tttctgaaaa aaagaaagag ggagagcaaa ccccaaccaa ttcattgaga 361 taatgagaca attttatgtg tggagtctca tgttcttcag atatcagaat acatgtcttt 421 ttctttagca ctcttggatt gctggcagct tattgattgc tacccttggc agacctgcag 481 aagcaatatg ctgatgtcgt gatcgaagtt ttaccgacac aattaattcc tgatgacaat 541 gaaaggaagg tgctgagagt tcgattggtg atgaaggaag gggtgaagta ttgcaatcca 601 gtttacctct tagatgaagg ctccaccg