LOCUS       DQ177780                 631 bp    DNA     linear   PLN 13-JAN-2006
DEFINITION  Chamaedorea metallica phosphoribulokinase-like protein 2 (PRK)
            gene, exons 4, 5 and partial cds.
ACCESSION   DQ177780
VERSION     DQ177780.1  GI:76881642
KEYWORDS    .
SOURCE      Chamaedorea metallica
  ORGANISM  Chamaedorea metallica
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Arecaceae; Arecoideae;
            Chamaedoreeae; Chamaedorea.
REFERENCE   1  (bases 1 to 631)
  AUTHORS   Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A.,
            Russell,S.J., Hodel,D.R. and Bateman,R.M.
  TITLE     Molecular phylogeny of the palm genus Chamaedorea, based on the
            low-copy nuclear genes PRK and RPB2
  JOURNAL   Mol. Phylogenet. Evol. 38 (2), 398-415 (2006)
   PUBMED   16249101
REFERENCE   2  (bases 1 to 631)
  AUTHORS   Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A.,
            Russell,S.J., Hodel,D.R. and Bateman,R.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-AUG-2005) Botany, Natural History Museum, Cromwell
            Road, London SW7 5BD, UK
FEATURES             Location/Qualifiers
     source          1..631
                     /organism="Chamaedorea metallica"
                     /mol_type="genomic DNA"
                     /specimen_voucher="Hodel 950 BH"
                     /db_xref="taxon:348477"
     gene            <1..>631
                     /gene="PRK"
     mRNA            join(<1..60,476..>631)
                     /gene="PRK"
                     /product="phosphoribulokinase-like protein 2"
     CDS             join(<1..60,476..>631)
                     /gene="PRK"
                     /codon_start=3
                     /product="phosphoribulokinase-like protein 2"
                     /protein_id="ABA56449.1"
                     /db_xref="GI:76881643"
                     /translation="LECIKASIGARKLDFDAYVDLQKQYADVVIEVLPTQLIPDDNER
                     KVLRVRLVMKEGVKYCNQVYLLDEGST"
     exon            <1..60
                     /gene="PRK"
                     /number=4
     exon            476..>631
                     /gene="PRK"
                     /number=5
ORIGIN      
        1 gtcttgagtg catcaaagcc agcattggag cgcgaaagct cgactttgat gcttatgttg
       61 gtatgtttct ttgccacagt gcctagttat tggtacttga agaattggca gggcattcat
      121 ttgttggtat aatatagagc aatttcatta gttttgattg ccaaatatag tactatactt
      181 caatatctag caaatgcttc attaaaaaaa gaaactcact aacaaagtat ctgatccata
      241 agtcaaataa tgcacaaaac atactggact aaaaatataa tcactccatg agaaatactt
      301 ttggatacct ttttctgaaa aaaagaaaga gggagagcaa accccaacca attcattgag
      361 ataatgagac aattttatgt gtggagtctc atgttcttca gatatcagaa tacttgtctt
      421 tttctttagc actcttggat tgctggcagc ttatatagat tgctaccctt ggcagacctg
      481 cagaagcaat atgctgatgt cgtgatcgaa gttttaccga cacaattaat tcctgatgac
      541 aatgaaagga aggtgctgag agttcgattg gtgatgaagg aaggggtgaa gtattgcaat
      601 caagtttacc tcttagatga aggctccacc g