LOCUS       DQ177782                 628 bp    DNA     linear   PLN 13-JAN-2006
DEFINITION  Chamaedorea elegans phosphoribulokinase-like protein 2 (PRK) gene,
            exons 4, 5 and partial cds.
ACCESSION   DQ177782
VERSION     DQ177782.1  GI:76881646
KEYWORDS    .
SOURCE      Chamaedorea elegans
  ORGANISM  Chamaedorea elegans
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Arecaceae; Arecoideae;
            Chamaedoreeae; Chamaedorea.
REFERENCE   1  (bases 1 to 628)
  AUTHORS   Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A.,
            Russell,S.J., Hodel,D.R. and Bateman,R.M.
  TITLE     Molecular phylogeny of the palm genus Chamaedorea, based on the
            low-copy nuclear genes PRK and RPB2
  JOURNAL   Mol. Phylogenet. Evol. 38 (2), 398-415 (2006)
   PUBMED   16249101
REFERENCE   2  (bases 1 to 628)
  AUTHORS   Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A.,
            Russell,S.J., Hodel,D.R. and Bateman,R.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-AUG-2005) Botany, Natural History Museum, Cromwell
            Road, London SW7 5BD, UK
FEATURES             Location/Qualifiers
     source          1..628
                     /organism="Chamaedorea elegans"
                     /mol_type="genomic DNA"
                     /specimen_voucher="Hodel 946 BH"
                     /db_xref="taxon:348465"
     gene            <1..>628
                     /gene="PRK"
     mRNA            join(<1..60,473..>628)
                     /gene="PRK"
                     /product="phosphoribulokinase-like protein 2"
     CDS             join(<1..60,473..>628)
                     /gene="PRK"
                     /codon_start=3
                     /product="phosphoribulokinase-like protein 2"
                     /protein_id="ABA56451.1"
                     /db_xref="GI:76881647"
                     /translation="LEGIKARIGARKLDFDAYVDLQKQYADVVIEVLPTQLIPDDNER
                     KVLRVRLVTKEGVKYCNPVYLLDEGST"
     exon            <1..60
                     /gene="PRK"
                     /number=4
     exon            473..>628
                     /gene="PRK"
                     /number=5
ORIGIN      
        1 gtcttgaggg catcaaagcc cgcattggag ctcgaaagct cgactttgat gcttatgttg
       61 gtatgtttct ttgccacagt gcctagttat tggtacttga agaattggca gagcattcat
      121 ttgttggtat aatatagagc aatttcatta gttttgattg caaaatatag tactatactt
      181 caatatctag caaatgcttc attaaaaaaa aaactcacta acaaagtatc tgatccataa
      241 gtcaaataat gcacaaaaca ttctggacta aaaatataat cactccatga gaaattcttt
      301 tggatacctt tttctgaaaa aaagaaagag ggagagcaaa ccccaaccaa ttcattgaga
      361 taatgagaca attttatgtg tggagtctcg tgttcttcag atatcagaat acatgtcttt
      421 ttctttagca ctcttggatt gctggcagct tatagattgc tacccttggc agacctgcag
      481 aagcaatatg ctgatgtcgt gatcgaagtt ttaccgacac aattaattcc tgatgacaat
      541 gaaaggaagg tgctgagagt tcgattggtg acgaaggaag gggtgaagta ttgcaatcca
      601 gtttacctct tagatgaagg ctccaccg