LOCUS DQ177790 628 bp DNA linear PLN 13-JAN-2006 DEFINITION Chamaedorea elatior phosphoribulokinase-like protein 2 (PRK) gene, exons 4, 5 and partial cds. ACCESSION DQ177790 VERSION DQ177790.1 GI:76881661 KEYWORDS . SOURCE Chamaedorea elatior ORGANISM Chamaedorea elatior Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Arecaceae; Arecoideae; Chamaedoreeae; Chamaedorea. REFERENCE 1 (bases 1 to 628) AUTHORS Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A., Russell,S.J., Hodel,D.R. and Bateman,R.M. TITLE Molecular phylogeny of the palm genus Chamaedorea, based on the low-copy nuclear genes PRK and RPB2 JOURNAL Mol. Phylogenet. Evol. 38 (2), 398-415 (2006) PUBMED 16249101 REFERENCE 2 (bases 1 to 628) AUTHORS Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A., Russell,S.J., Hodel,D.R. and Bateman,R.M. TITLE Direct Submission JOURNAL Submitted (19-AUG-2005) Botany, Natural History Museum, Cromwell Road, London SW7 5BD, UK FEATURES Location/Qualifiers source 1..628 /organism="Chamaedorea elatior" /mol_type="genomic DNA" /specimen_voucher="Baker 1175 K" /db_xref="taxon:348464" gene <1..>628 /gene="PRK" mRNA join(<1..60,473..>628) /gene="PRK" /product="phosphoribulokinase-like protein 2" CDS join(<1..60,473..>628) /gene="PRK" /codon_start=3 /product="phosphoribulokinase-like protein 2" /protein_id="ABA56458.1" /db_xref="GI:76881662" /translation="LECIKASIGARKLDFDAYVDLQKQYADVVIEVLPTQLIPDDNER KVLRVRLVMKEGVKYCNPVYLLDEGST" exon <1..60 /gene="PRK" /number=4 exon 473..>628 /gene="PRK" /number=5 ORIGIN 1 gtcttgagtg catcaaagcc agcattggag ctcgaaagct cgactttgat gcttatgttg 61 gtatgtttct ttgccacggt gcctagttat tggtacttga agaattggca gagcattcat 121 ttgttggtat aatatagagc aatttcatta gttttgattg ccaaatatag tactatactt 181 caatatctag caaatgcttc attaaaaaaa gaactcgcta acaaagtatc tgatccataa 241 gtcaaataat gcacaaaaca tactggacta aaaatataat cactccatga gaaatacttt 301 tggatacctt twtctgaaaa aaagaaagag ggagagcaaa ccccaaccaa ttcattgaga 361 taatgagaca attttatgtg tggagtctca tgttcttcag atatcagaat acatgtcttt 421 ttctttagca ctcttggatt gctggcagct tattgattgc tatccttggc agacctgcag 481 aagcaatatg ctgatgtcgt gatcgaagtt ttaccgacac aattaattcc tgatgacaat 541 gaaaggaagg tgctgagagt tcgattggtg atgaaggaag gggtgaagta ttgcaatcca 601 gtttatctct tagatgaagg ctccaccg