LOCUS       DQ177791                 628 bp    DNA     linear   PLN 13-JAN-2006
DEFINITION  Chamaedorea linearis phosphoribulokinase-like protein 2 (PRK) gene,
            exons 4, 5 and partial cds.
ACCESSION   DQ177791
VERSION     DQ177791.1  GI:76881663
KEYWORDS    .
SOURCE      Chamaedorea linearis
  ORGANISM  Chamaedorea linearis
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Arecaceae; Arecoideae;
            Chamaedoreeae; Chamaedorea.
REFERENCE   1  (bases 1 to 628)
  AUTHORS   Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A.,
            Russell,S.J., Hodel,D.R. and Bateman,R.M.
  TITLE     Molecular phylogeny of the palm genus Chamaedorea, based on the
            low-copy nuclear genes PRK and RPB2
  JOURNAL   Mol. Phylogenet. Evol. 38 (2), 398-415 (2006)
   PUBMED   16249101
REFERENCE   2  (bases 1 to 628)
  AUTHORS   Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A.,
            Russell,S.J., Hodel,D.R. and Bateman,R.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-AUG-2005) Botany, Natural History Museum, Cromwell
            Road, London SW7 5BD, UK
FEATURES             Location/Qualifiers
     source          1..628
                     /organism="Chamaedorea linearis"
                     /mol_type="genomic DNA"
                     /specimen_voucher="Villa 2032 NHM"
                     /db_xref="taxon:348475"
     gene            <1..>628
                     /gene="PRK"
     mRNA            join(<1..60,473..>628)
                     /gene="PRK"
                     /product="phosphoribulokinase-like protein 2"
     CDS             join(<1..60,473..>628)
                     /gene="PRK"
                     /codon_start=3
                     /product="phosphoribulokinase-like protein 2"
                     /protein_id="ABA56459.1"
                     /db_xref="GI:76881664"
                     /translation="LECIKASIGARKLDFDAYVDLQKQYADVVIEVLPTQLIPDDNER
                     KVLRVRLVMKEGVKYCNPVYLLDEGST"
     exon            <1..60
                     /gene="PRK"
                     /number=4
     exon            473..>628
                     /gene="PRK"
                     /number=5
ORIGIN      
        1 gtcttgagtg catcaaagcc agcattggag ctcgaaagct cgactttgat gcttatgttg
       61 gtatgtttct ttgccacagt gcctagttat tggtacttga agaattggca gagcattcat
      121 ttgttggtat aatatagagc aatttcatta gttttgattg ccaaatatag tactatactt
      181 caatatctag caaatgcttc attaaaaaaa gaactcgcta acaaagtatc tgatccataa
      241 gtcaaataat gcacaaaaca tactggacta aaaaaataat cactccatga gaaatacttt
      301 tggatacctt tttctgaaaa aaagaaagag ggagagcaaa ccccaaccaa ttcattgaga
      361 taatgagaca attttatgtg tggagtctcg tgttcttcag atatcagaat acacgtcttt
      421 ttctttagca ctcttggatt gctggcagct tatagattgc tacccttggc agacctgcag
      481 aagcaatatg ctgatgtcgt gatcgaagtt ttaccgacac aattaattcc tgatgacaat
      541 gaaaggaagg tgctgagagt tcgattggtg atgaaggaag gggtgaagta ttgcaatcca
      601 gtttacctct tagatgaagg ctccaccg