LOCUS       DQ177794                 628 bp    DNA     linear   PLN 13-JAN-2006
DEFINITION  Chamaedorea woodsoniana phosphoribulokinase-like protein 2 (PRK)
            gene, exons 4, 5 and partial cds.
ACCESSION   DQ177794
VERSION     DQ177794.1  GI:76881669
KEYWORDS    .
SOURCE      Chamaedorea woodsoniana
  ORGANISM  Chamaedorea woodsoniana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Arecaceae; Arecoideae;
            Chamaedoreeae; Chamaedorea.
REFERENCE   1  (bases 1 to 628)
  AUTHORS   Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A.,
            Russell,S.J., Hodel,D.R. and Bateman,R.M.
  TITLE     Molecular phylogeny of the palm genus Chamaedorea, based on the
            low-copy nuclear genes PRK and RPB2
  JOURNAL   Mol. Phylogenet. Evol. 38 (2), 398-415 (2006)
   PUBMED   16249101
REFERENCE   2  (bases 1 to 628)
  AUTHORS   Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A.,
            Russell,S.J., Hodel,D.R. and Bateman,R.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-AUG-2005) Botany, Natural History Museum, Cromwell
            Road, London SW7 5BD, UK
FEATURES             Location/Qualifiers
     source          1..628
                     /organism="Chamaedorea woodsoniana"
                     /mol_type="genomic DNA"
                     /specimen_voucher="Hodel 1187 BH"
                     /db_xref="taxon:348508"
     gene            <1..>628
                     /gene="PRK"
     mRNA            join(<1..60,473..>628)
                     /gene="PRK"
                     /product="phosphoribulokinase-like protein 2"
     CDS             join(<1..60,473..>628)
                     /gene="PRK"
                     /codon_start=3
                     /product="phosphoribulokinase-like protein 2"
                     /protein_id="ABA56462.1"
                     /db_xref="GI:76881670"
                     /translation="LECIKASIGARKLDFDAYVDLQKQYADVVIEVLPTQLIPDDNER
                     KVLRVRLVMKEGVKYCNPVYLLDEGST"
     exon            <1..60
                     /gene="PRK"
                     /number=4
     exon            473..>628
                     /gene="PRK"
                     /number=5
ORIGIN      
        1 gtcttgagtg catcaaagcc agcattggag ctcgaaagct cgactttgat gcttatgttg
       61 gtatgtttct ttgccacagt gcctagttat tggtacttga agaattggca gagcattcct
      121 ttgttggtat aatatagagc aatttcatta gttttgattg ccaaatatag tactatactt
      181 caatatctag caaatgcttc attacaaaaa gaactcacta acaaagtatc tgatccataa
      241 gtcaaataat gcacaaaaca tactggacta aaaatataat cactccatga gaaatacttt
      301 tggatacctt tttctgaaaa aaagaaagag ggagagcaaa ccccaaccaa ttcattgaga
      361 taatgagaca attttatgtg tggagtctca tgttcttcag atatcagaat acatgtcttt
      421 ttctttagca ctcttggatt gctggcagct tattgattgc tacccttggc agacctgcag
      481 aagcaatatg ctgatgtcgt gatcgaagtt ttaccgacac aattaattcc tgatgacaat
      541 gaaaggaagg tgctgagagt tcgattggtg atgaaggaag gggtgaagta ttgcaatcca
      601 gtttacctct tagatgaagg ctccaccg