LOCUS       DQ177796                 629 bp    DNA     linear   PLN 13-JAN-2006
DEFINITION  Chamaedorea rhizomatosa phosphoribulokinase-like protein 2 (PRK)
            gene, exons 4, 5 and partial cds.
ACCESSION   DQ177796
VERSION     DQ177796.1  GI:76881672
KEYWORDS    .
SOURCE      Chamaedorea rhizomatosa
  ORGANISM  Chamaedorea rhizomatosa
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Arecaceae; Arecoideae;
            Chamaedoreeae; Chamaedorea.
REFERENCE   1  (bases 1 to 629)
  AUTHORS   Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A.,
            Russell,S.J., Hodel,D.R. and Bateman,R.M.
  TITLE     Molecular phylogeny of the palm genus Chamaedorea, based on the
            low-copy nuclear genes PRK and RPB2
  JOURNAL   Mol. Phylogenet. Evol. 38 (2), 398-415 (2006)
   PUBMED   16249101
REFERENCE   2  (bases 1 to 629)
  AUTHORS   Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A.,
            Russell,S.J., Hodel,D.R. and Bateman,R.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-AUG-2005) Botany, Natural History Museum, Cromwell
            Road, London SW7 5BD, UK
FEATURES             Location/Qualifiers
     source          1..629
                     /organism="Chamaedorea rhizomatosa"
                     /mol_type="genomic DNA"
                     /specimen_voucher="Hodel 936 BH"
                     /db_xref="taxon:348570"
     gene            <1..>629
                     /gene="PRK"
     mRNA            join(<1..60,474..>629)
                     /gene="PRK"
                     /product="phosphoribulokinase-like protein 2"
     CDS             join(<1..60,474..>629)
                     /gene="PRK"
                     /codon_start=3
                     /product="phosphoribulokinase-like protein 2"
                     /protein_id="ABA56463.1"
                     /db_xref="GI:76881673"
                     /translation="LECIKASIGAQKLDFDAYVDLQKQYADVVIEVLPTQLIPDDNER
                     KVLRVRSVMKEGVKYCNPVYLLDEGST"
     exon            <1..60
                     /gene="PRK"
                     /number=4
     exon            474..>629
                     /gene="PRK"
                     /number=5
ORIGIN      
        1 gtcttgagtg catcaaagcc agcattggag cgcaaaagct cgactttgat gcttatgttg
       61 gtatgtttct ttgccacagt gcctagttat tggtacttga agaattggca gggcattcat
      121 ttgttggtat aatatagagc aatttcatta gttttgattg ccaaatatag tactatactt
      181 caatatctag caaatgcttc attaaaaaaa aaaactcacg aacaaagtat ctgatccata
      241 agtcaaataa tgcacaaaac atactggact aaaaatataa tcactccatg agaaatactt
      301 ttggatacct ttttctgaaa aaaagaaaga gggagagcaa accccaacca attcattgag
      361 ataatgagac aattttatgt gtggagtctc atgttcttca gatatcagaa tacatgtctt
      421 tttctttagc actcttggat tgctggcagc ttatagattg ctacccttgg cagacctgca
      481 gaagcaatat gctgatgtcg tgatcgaagt tttaccgaca caattaattc ctgatgacaa
      541 tgaaaggaag gtgctgagag ttcgatcggt gatgaaggaa ggggtgaagt attgcaatcc
      601 agtttacctc ttagatgaag gctccaccg