LOCUS       DQ177809                 628 bp    DNA     linear   PLN 13-JAN-2006
DEFINITION  Chamaedorea rossteniorum phosphoribulokinase-like protein 2 (PRK)
            gene, exons 4, 5 and partial cds.
ACCESSION   DQ177809
VERSION     DQ177809.1  GI:76881695
KEYWORDS    .
SOURCE      Chamaedorea rossteniorum
  ORGANISM  Chamaedorea rossteniorum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Arecaceae; Arecoideae;
            Chamaedoreeae; Chamaedorea.
REFERENCE   1  (bases 1 to 628)
  AUTHORS   Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A.,
            Russell,S.J., Hodel,D.R. and Bateman,R.M.
  TITLE     Molecular phylogeny of the palm genus Chamaedorea, based on the
            low-copy nuclear genes PRK and RPB2
  JOURNAL   Mol. Phylogenet. Evol. 38 (2), 398-415 (2006)
   PUBMED   16249101
REFERENCE   2  (bases 1 to 628)
  AUTHORS   Thomas,M.M., Garwood,N.C., Baker,W.J., Henderson,S.A.,
            Russell,S.J., Hodel,D.R. and Bateman,R.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-AUG-2005) Botany, Natural History Museum, Cromwell
            Road, London SW7 5BD, UK
FEATURES             Location/Qualifiers
     source          1..628
                     /organism="Chamaedorea rossteniorum"
                     /mol_type="genomic DNA"
                     /specimen_voucher="Hodel 1544 BH"
                     /db_xref="taxon:348494"
     gene            <1..>628
                     /gene="PRK"
     mRNA            join(<1..60,473..>628)
                     /gene="PRK"
                     /product="phosphoribulokinase-like protein 2"
     CDS             join(<1..60,473..>628)
                     /gene="PRK"
                     /codon_start=3
                     /product="phosphoribulokinase-like protein 2"
                     /protein_id="ABA56473.1"
                     /db_xref="GI:76881696"
                     /translation="LECIKASIGARKLDFDAYVDLQKQYADVVIEVLPTQLIPDDNER
                     KVLRVRLVMKEGVKYCNPVYLLDEGST"
     exon            <1..60
                     /gene="PRK"
                     /number=4
     exon            473..>628
                     /gene="PRK"
                     /number=5
ORIGIN      
        1 gtcttgagtg catcaaagcc agcattggag ctcgaaagct cgactttgat gcttatgttg
       61 gtatgtttct ttgccacggt gcctagttat tggtacttga agaattggca gagcattcat
      121 ttgttggtat aatatagagc aatttcatta gttttgattg ccaaatatag tactatactt
      181 caatatctag caaatgcttc attaaaaaaa gaactcgcta acaaagtatc tgatccataa
      241 gtcaaataat gcacaaaaca tactggacta aaaatataat cactccatga gaaatacttt
      301 tggatacctt tttctgaaaa aaagaaagcg ggagagcaaa ccccagccaa ttcattgaga
      361 taatgagaca attttatgtg tggagtctca tgttcttcag atatcagaat acatgtcttt
      421 ttctttagca ctcttggatt gctggcagct tattgattgc tatccttggc agacctgcag
      481 aagcaatatg ctgatgtcgt gatcgaagtt ttaccgacac aattaattcc tgatgacaat
      541 gaaaggaagg tgctgagagt tcgattggtg atgaaggaag gggtgaagta ttgcaatcca
      601 gtttatctct tagatgaagg ctccaccg